PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0060s0233.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family NF-YC
Protein Properties Length: 254aa    MW: 27606.5 Da    PI: 4.6121
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0060s0233.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC37.35.7e-121693098
                NF-YC 30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                         ++adedv +i+  +Pvl+ska elf+ +l   ++  + ++  +t+    ++ +v+r  ifdfl ++v +
  Kaladp0060s0233.2.p  1 MQADEDVGKIAMAVPVLVSKALELFLQDLCDHTYGITVQTGAKTVSSLHLKHCVQRYSIFDFLSEVVSK 69
                         899*************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471132.72E-18171IPR009072Histone-fold
PfamPF008082.0E-11154IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.101.8E-17168IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005829Cellular Componentcytosol
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MQADEDVGKI AMAVPVLVSK ALELFLQDLC DHTYGITVQT GAKTVSSLHL KHCVQRYSIF  60
DFLSEVVSKV PDYSHSGTSG EVRTISRRRK AAGDDLTDSD EDSKRSRLPE TGHATGGGRG  120
RGRGRGRGRG RVGRMAEPDN VQHDFEPEAS MVNLDAAQAN DSKGRDLLSN VKEEADGLTN  180
PAVGKFDLNA EIKENESMPS SEVPDILSEH AVIKQERIPG WSLSEIDRLN INPLQLGSMN  240
SALDDEDYDE EDG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120129RGRGRGRGRG
2120130RGRGRGRGRGR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006432367.13e-71hypothetical protein CICLE_v10002081mg
TrEMBLV4SXS03e-71V4SXS0_9R
STRINGBra009295.1-P4e-58(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.13e-53nuclear factor Y, subunit C11